DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxc1a

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a / 58046 ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio


Alignment Length:95 Identity:51/95 - (53%)
Similarity:61/95 - (64%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RSSEK---SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLK 99
            |.|::   |..|||.|::.||.|||:|||.||||.|.|||||:..|.|:|.||||||||||||.|
Zfish   207 RDSDEDTSSGGSRTNFTTKQLTELEKEFHFNKYLTRARRIEIANPLQLSETQVKIWFQNRRMKQK 271

  Fly   100 KSTNRKGAIGALTTSIPLSSQSSEDLQKDD 129
            |.. |:|    |...:.|.|...||.:|.|
Zfish   272 KML-REG----LAQGLMLISGCDEDSKKSD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 37/52 (71%)
hoxc1aNP_571606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224 7/16 (44%)
Homeobox 218..271 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.