DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxa5

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001011405.1 Gene:hoxa5 / 496880 XenbaseID:XB-GENE-486061 Length:274 Species:Xenopus tropicalis


Alignment Length:64 Identity:39/64 - (60%)
Similarity:49/64 - (76%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK 105
            :.||:|||::..|.:|||:|||.|:||.|.|||||:..|.|:|||:||||||||||.||....|
 Frog   198 EGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 36/55 (65%)
hoxa5NP_001011405.1 Homeodomain 200..256 CDD:459649 36/55 (65%)

Return to query results.
Submit another query.