DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxa1

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001008017.1 Gene:hoxa1 / 493379 XenbaseID:XB-GENE-480737 Length:323 Species:Xenopus tropicalis


Alignment Length:146 Identity:55/146 - (37%)
Similarity:77/146 - (52%) Gaps:26/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ENYFVDNY--SVSDLMM-------YPCVE-----------LNVEAAPTATTRSSE-----KSKRS 46
            :|..|.||  :||.|.:       .|..|           :.|:..|..|.::.|     :...:
 Frog   156 QNISVANYNNNVSSLHISQREVCRSPSSETSPGPAQTFDWMKVKRNPPKTGKAGEYGFAGQPNTA 220

  Fly    47 RTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGAL 111
            ||.|::.||.|||:|||.||||.|.||:||:..|.|.|.||||||||||||.|| ..::|.:...
 Frog   221 RTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKK-REKEGLLPIS 284

  Fly   112 TTSIPLSSQSSEDLQK 127
            .::...|.:.||:|.:
 Frog   285 PSASTGSDEKSEELSE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
hoxa1NP_001008017.1 Homeobox 221..274 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.