powered by:
Protein Alignment zen2 and Abd-B
DIOPT Version :9
Sequence 1: | NP_476794.1 |
Gene: | zen2 / 40827 |
FlyBaseID: | FBgn0004054 |
Length: | 252 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001303472.1 |
Gene: | Abd-B / 47763 |
FlyBaseID: | FBgn0000015 |
Length: | 493 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 32/62 - (51%) |
Similarity: | 47/62 - (75%) |
Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 KRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK 105
::.|..:|..|.:|||:||..|.|:::.:|.|:::.|.||||||||||||||||.||::.|:
Fly 388 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQ 449
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45439757 |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.930 |
|
Return to query results.
Submit another query.