Sequence 1: | NP_476794.1 | Gene: | zen2 / 40827 | FlyBaseID: | FBgn0004054 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001009885.1 | Gene: | mnx1 / 405399 | ZFINID: | ZDB-GENE-040409-1 | Length: | 311 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 59/198 - (29%) |
---|---|---|---|
Similarity: | 99/198 - (50%) | Gaps: | 48/198 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 IQSENYFVDNY---SVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLN 65
Fly 66 KYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSED------ 124
Fly 125 ---------LQKDDQIVE-----RLLRYANTNVETAPLRQVDHGVLEEGQITPPYQSYDYLHEFS 175
Fly 176 PEP 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
zen2 | NP_476794.1 | Homeobox | 46..99 | CDD:278475 | 35/52 (67%) |
mnx1 | NP_001009885.1 | Homeobox | 180..233 | CDD:278475 | 35/52 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |