DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxc9

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001094377.1 Gene:Hoxc9 / 368178 RGDID:1595784 Length:260 Species:Rattus norvegicus


Alignment Length:73 Identity:36/73 - (49%)
Similarity:48/73 - (65%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMK 97
            |.|....:..:::.|..::..|.:|||:||..|.||.|.||.|:::.|.||||||||||||||||
  Rat   182 PVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMK 246

  Fly    98 LKKSTNRK 105
            :||....|
  Rat   247 MKKMNKEK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 31/55 (56%)
Hoxc9NP_001094377.1 Hox9_act 1..179 CDD:461369
Homeodomain 193..241 CDD:459649 24/47 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.