DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Barx1

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001102350.1 Gene:Barx1 / 364680 RGDID:1310884 Length:254 Species:Rattus norvegicus


Alignment Length:92 Identity:39/92 - (42%)
Similarity:57/92 - (61%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNR 104
            ::|.:||||.|:.|||:.||:.|...|||:...||::::.|.|::.|||.|:||||||.||...:
  Rat   139 AKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQ 203

  Fly   105 KGAIGALT--------TSIPLSSQSSE 123
            .|.:.:.|        .|||.|.|.:|
  Rat   204 GGGLESPTKPKGRPKKNSIPTSEQLTE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 28/55 (51%)
Barx1NP_001102350.1 Homeodomain 143..199 CDD:459649 28/55 (51%)

Return to query results.
Submit another query.