DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Gsx2

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:140 Identity:55/140 - (39%)
Similarity:73/140 - (52%) Gaps:18/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQ 78
            |:|||...:.|:.:.     .:.|......||.||||:|.||:||||||..|.||:|.|||||:.
  Rat   179 YNVSDPRRFHCLTMG-----GSDTSQVPNGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIAT 238

  Fly    79 RLALTERQVKIWFQNRRMKLKK-----STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRY 138
            .|.|:|:||||||||||:|.||     |.|...:...:.:....:....||......        
  Rat   239 YLNLSEKQVKIWFQNRRVKHKKEGKGASRNNHASCKCVGSQAHYARSEDEDSLSPAS-------- 295

  Fly   139 ANTNVETAPL 148
            ||.:.|.:||
  Rat   296 ANEDKEISPL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348945
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.