DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and HOXD3

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_008829.3 Gene:HOXD3 / 3232 HGNCID:5137 Length:432 Species:Homo sapiens


Alignment Length:236 Identity:77/236 - (32%)
Similarity:99/236 - (41%) Gaps:75/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGA 107
            |||.|||::|.||:|||:|||.|:||.|.||:|::..|.|||||:||||||||||.||....||.
Human   194 SKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGI 258

  Fly   108 IGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITP-PYQSYD-- 169
            :.:     | :|||.|                    .:.||......|...||:.| |..:||  
Human   259 LHS-----P-ASQSPE--------------------RSPPLGGAAGHVAYSGQLPPVPGLAYDAP 297

  Fly   170 --------------------------------YLHEFSPEPMALPQLPFNEFDANWASSWLGLEP 202
                                            ...||.|.|||       .....:||:.|...|
Human   298 SPPAFAKSQPNMYGLAAYTAPLSSCLPQQKRYAAPEFEPHPMA-------SNGGGFASANLQGSP 355

  Fly   203 TIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDY 243
             :.:..|.:|........:.|....|:.||||      |||
Human   356 -VYVGGNFVESMAPASGPVFNLGHLSHPSSAS------VDY 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
HOXD3NP_008829.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..197 2/2 (100%)
Antp-type hexapeptide 160..165
Homeobox 198..250 CDD:306543 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..280 9/52 (17%)
DUF4074 369..430 CDD:315871 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.