Sequence 1: | NP_476794.1 | Gene: | zen2 / 40827 | FlyBaseID: | FBgn0004054 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008829.3 | Gene: | HOXD3 / 3232 | HGNCID: | 5137 | Length: | 432 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 77/236 - (32%) |
---|---|---|---|
Similarity: | 99/236 - (41%) | Gaps: | 75/236 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGA 107
Fly 108 IGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITP-PYQSYD-- 169
Fly 170 --------------------------------YLHEFSPEPMALPQLPFNEFDANWASSWLGLEP 202
Fly 203 TIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDY 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
zen2 | NP_476794.1 | Homeobox | 46..99 | CDD:278475 | 35/52 (67%) |
HOXD3 | NP_008829.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 43..62 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..197 | 2/2 (100%) | |||
Antp-type hexapeptide | 160..165 | ||||
Homeobox | 198..250 | CDD:306543 | 35/51 (69%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 253..280 | 9/52 (17%) | |||
DUF4074 | 369..430 | CDD:315871 | 9/27 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 400..432 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |