DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and HOXB1

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens


Alignment Length:106 Identity:48/106 - (45%)
Similarity:60/106 - (56%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNVEAAPTATTRSSEKSKRS----RTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQV 87
            :.|:..|..|.:.||....|    ||.|::.||.|||:|||.||||:|.||:||:..|.|.|.||
Human   183 MKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQV 247

  Fly    88 KIWFQNRRMKLKKSTNRKGAIGALTTSIP------LSSQSS 122
            ||||||||||.||....:|.:.......|      .|.||:
Human   248 KIWFQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQST 288

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/56 (64%)
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149