DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxc3a

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:169 Identity:61/169 - (36%)
Similarity:82/169 - (48%) Gaps:38/169 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIQSENYFVDNYSVSDLMMYPCVELNVEAAPT-------------------ATTRSSEKSKRSRT 48
            |::.|.....:.|....|.||.  :....|||                   |..|:| .|||:|.
Zfish   102 ALEREKACELSTSCLSTMKYPW--MRETHAPTHFSSINAMESGDSKYSNGEAVVRNS-SSKRARV 163

  Fly    49 AFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTT 113
            ||:|.||:|||:|||.:.||.|.||:|:::.|.||:||:||||||||||.||....|        
Zfish   164 AFTSSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEK-------- 220

  Fly   114 SIPLSSQSSEDLQKDDQIVERL-------LRYANTNVET 145
            |...||.:....:....|:.|.       |::.| |.||
Zfish   221 STAKSSYTYLGTENQPLIISRSTTDSPVPLKFQN-NYET 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 33/52 (63%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 50/133 (38%)
Homeobox 162..214 CDD:306543 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.