DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxb8b

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571256.1 Gene:hoxb8b / 30420 ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio


Alignment Length:109 Identity:50/109 - (45%)
Similarity:62/109 - (56%) Gaps:14/109 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PC-VELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQ 86
            || .:|.....|.||.|     :|.|..:|..|.:|||:||..|.||.|.||||:|..|||||||
Zfish   129 PCTAQLFPWMRPQATGR-----RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALALTERQ 188

  Fly    87 VKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDDQ 130
            |||||||||||.||..|:        ...|.|....|:::::.|
Zfish   189 VKIWFQNRRMKWKKEHNK--------DKFPSSKAEQEEIERERQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139 1/4 (25%)
Homeobox 149..201 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..247 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.