DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and dbx2

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_073798768.1 Gene:dbx2 / 30417 ZFINID:ZDB-GENE-000128-13 Length:199 Species:Danio rerio


Alignment Length:73 Identity:32/73 - (43%)
Similarity:43/73 - (58%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMK 97
            |...:||.....| |..||..|..|||:.|...||:::|.|..::..|:|.|.||||||||||||
Zfish    90 PAINSRSRPGILR-RAVFSEEQRRELEKTFSKQKYISKTERNRLASELSLKETQVKIWFQNRRMK 153

  Fly    98 LKKSTNRK 105
            .:.|..::
Zfish   154 WRNSREKE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 28/55 (51%)
dbx2XP_073798768.1 None

Return to query results.
Submit another query.