DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxc11a

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571240.1 Gene:hoxc11a / 30403 ZFINID:ZDB-GENE-990415-111 Length:306 Species:Danio rerio


Alignment Length:69 Identity:33/69 - (47%)
Similarity:50/69 - (72%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 APTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRM 96
            |..::..|:.::::.|..:|..|:.||||||..|.|:.:.:|:::|:.|.||:||||||||||||
Zfish   223 ASKSSHSSTPRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRM 287

  Fly    97 KLKK 100
            |.||
Zfish   288 KEKK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 29/55 (53%)
hoxc11aNP_571240.1 DUF3528 42..167 CDD:432284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..238 2/14 (14%)
Homeodomain 235..291 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.