DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxb3

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:155 Identity:60/155 - (38%)
Similarity:76/155 - (49%) Gaps:39/155 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNR 104
            |..|||:|||::|.||:|||:|||.|:||.|.||:|::..|.|:|||:||||||||||.||....
  Rat   184 SAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKA 248

  Fly   105 KGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQSYD 169
            ||...:.....|..| ..:.:|                 .||......|      .:||   |||
  Rat   249 KGLASSSGGPSPAGS-PPQPMQ-----------------STAGFMNALH------SMTP---SYD 286

  Fly   170 YLHEFSPEPMALPQ-------LPFN 187
                 ||.|.|..:       ||.|
  Rat   287 -----SPSPPAFSKGHQNAYALPSN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/52 (65%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 34/52 (65%)
DUF4074 365..427 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.