DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxb4a

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:109 Identity:49/109 - (44%)
Similarity:65/109 - (59%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SVSDLMMYPC---VELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEI 76
            |..|.::||.   |.:|:    .:...|..:.||||||::..|::|||:|||.|:||.|.||:||
Zfish   124 SRKDPVVYPWMKKVHVNI----VSPNYSGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEI 184

  Fly    77 SQRLALTERQVKIWFQNRRMKLKK--------------STNRKG 106
            :..|.|:|||:||||||||||.||              |||..|
Zfish   185 AHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSNSASTNSSG 228

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/52 (65%)