DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxb2a

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio


Alignment Length:258 Identity:82/258 - (31%)
Similarity:110/258 - (42%) Gaps:85/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKST--NRK 105
            |:|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:||||||||.|:.|  :|.
Zfish   158 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTTHHRD 222

  Fly   106 GAIG---------ALTTSIPLSSQSSE------DLQKDDQIVERLLRYANTNVETAPLRQVDHGV 155
            |..|         ....|.|.||||.|      ....:.:.......|.|::.::.|       .
Zfish   223 GQEGEPSGFDLLEGTDASSPYSSQSLEVSGSGSAAPSESETCPTTAAYTNSSDKSQP-------T 280

  Fly   156 LEEGQITPPYQSYDYLHEFSPEPMALPQL-----PFNEFDANWASSWLGLEPTIPIAENVI---- 211
            .||||.:            .|||.::|..     |:               || |.|:|..    
Zfish   281 PEEGQAS------------QPEPASVPDTAVHSPPY---------------PT-PTADNPTTMAE 317

  Fly   212 ------EHN-TQDQ-----PMIQNFCWDS------------NSSSASSSDILDVDYDFIQNLL 250
                  ||: |:.|     |.:..|..||            .||..|..|..:.|:|...:.|
Zfish   318 GRAAGPEHSFTEPQDATSLPDLNFFSTDSCLQISDALSPSLQSSLDSPVDFSEEDFDLFTSTL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100
Antp-type hexapeptide 103..108
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155
Homeobox 162..214 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 35/161 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.