DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxa2b

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio


Alignment Length:257 Identity:77/257 - (29%)
Similarity:105/257 - (40%) Gaps:59/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNR 94
            :.:|..:...|..::|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:|||||
Zfish   120 QGSPEISDGGSGATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNR 184

  Fly    95 RMKLKKSTNRK------GAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYA----NTNVETAPLR 149
            |||.|:.|..|      |...:|..:.......|...|..:.:...||...    ..|..|:...
Zfish   185 RMKHKRQTQCKENHHGDGKPPSLEEAGGRGDGKSFFEQVANNVSGALLEREGYPFQQNTLTSQQS 249

  Fly   150 QVDHGVLEEGQITPPYQSYD-YLHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIE- 212
            |..|....:.....|..|.| :|..| |.|                      .||:||....:. 
Zfish   250 QNGHNSDSQSATVSPLGSNDKHLKHF-PNP----------------------SPTVPICTTTMAP 291

  Fly   213 --HNTQD-------QPMIQNFCWDSNSSSASSSDIL------DVD---------YDFIQNLL 250
              .:.||       ...:|:|...||.|....||.:      .||         :||....|
Zfish   292 DCASAQDNGSPSALDVSLQDFNVFSNDSCLHLSDAVSPSLSESVDSPIGLTTEAFDFFSETL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 2/11 (18%)
Antp-type hexapeptide 88..93
Homeobox 137..189 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279 10/56 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.