DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and TLX3

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_066305.2 Gene:TLX3 / 30012 HGNCID:13532 Length:291 Species:Homo sapiens


Alignment Length:120 Identity:38/120 - (31%)
Similarity:61/120 - (50%) Gaps:28/120 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKST 102
            |:..|.|:.||:||.:|:.|||:.||..||||...|..:::.|.:|:.|||.||||||.|.::  
Human   161 RTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRR-- 223

  Fly   103 NRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLL---------RYANTNVETAPL 148
                             |::|:.:.:.|...||:         :..|.:::..||
Human   224 -----------------QTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 28/55 (51%)
TLX3NP_066305.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Homeodomain 167..223 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.