DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxd3

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001257967.1 Gene:Hoxd3 / 288152 RGDID:1588601 Length:432 Species:Rattus norvegicus


Alignment Length:198 Identity:67/198 - (33%)
Similarity:94/198 - (47%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGA 107
            |||.|||::|.||:|||:|||.|:||.|.||:|::..|.|||||:||||||||||.||....||.
  Rat   194 SKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGI 258

  Fly   108 IGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITP-PYQSYDYL 171
            :.:     | :.||.|                    .:.||......|...||:.| |..:||  
  Rat   259 LHS-----P-AGQSPE--------------------RSPPLGGAAGHVAYSGQLPPVPGLAYD-- 295

  Fly   172 HEFSPEPMALPQLPFNEFDANWASSWLGLEP-TIPIAENVIEHNTQDQPMIQNFCWDSNSSSASS 235
               :|.|.|..:...|.:         ||.. |.|::..:.:......|..:.....||....:|
  Rat   296 ---APSPPAFAKSQPNMY---------GLAAYTAPLSSCLPQQKRYAAPEFEPHPMASNGGGFAS 348

  Fly   236 SDI 238
            :::
  Rat   349 ANL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
Hoxd3NP_001257967.1 Homeobox 198..251 CDD:395001 35/52 (67%)
DUF4074 369..430 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.