DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and GSX1

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 / 219409 HGNCID:20374 Length:264 Species:Homo sapiens


Alignment Length:145 Identity:55/145 - (37%)
Similarity:80/145 - (55%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEIS 77
            :|.:.|...:.|:.::      :::.....|||.||||:|.||:||||||..|.||:|.|||||:
Human   123 SYPLPDPRQFHCISVD------SSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIA 181

  Fly    78 QRLALTERQVKIWFQNRRMKLK---KSTNRKGAIG----------------ALTTS--------I 115
            ..|.|:|:||||||||||:|.|   |.:|.:|..|                :|:::        :
Human   182 TYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGGAGGGGSAPQGCKCASLSSAKCSEDDDEL 246

  Fly   116 PLSSQSSEDLQKDDQ 130
            |:|..||   .|||:
Human   247 PMSPSSS---GKDDR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
GSX1NP_663632.1 SNAG domain. /evidence=ECO:0000250 1..20
Homeobox 151..204 CDD:395001 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..264 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.