DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and EVX1

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001980.1 Gene:EVX1 / 2128 HGNCID:3506 Length:407 Species:Homo sapiens


Alignment Length:67 Identity:30/67 - (44%)
Similarity:45/67 - (67%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKL 98
            |....:|::.:|.||||:..|:..||:||:...|::|.||.|::..|.|.|..:|:||||||||.
Human   174 TLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKD 238

  Fly    99 KK 100
            |:
Human   239 KR 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 27/55 (49%)
EVX1NP_001980.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..179 1/4 (25%)
Homeodomain 184..240 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.