DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Pdx1

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus


Alignment Length:169 Identity:59/169 - (34%)
Similarity:83/169 - (49%) Gaps:42/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLK 99
            |.|...|::||:|||::..||:|||:||..|||::|.||:|::..|.||||.:||||||||||.|
Mouse   139 AYTAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWK 203

  Fly   100 KSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIV--ERLLRYANTNVETAPL------------RQ 150
            |..::|.:.|.     |......|:.::|..:.  |.||       ...||            ..
Mouse   204 KEEDKKRSSGT-----PSGGGGGEEPEQDCAVTSGEELL-------AVPPLPPPGGAVPPGVPAA 256

  Fly   151 VDHGVLEEGQITPPYQSYDYLHEFSPEPMAL----PQLP 185
            |..|:|..|.            ..||:|.::    ||.|
Mouse   257 VREGLLPSGL------------SVSPQPSSIAPLRPQEP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 32/52 (62%)
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116
Antp-type hexapeptide 119..124
Homeobox 150..203 CDD:278475 32/52 (62%)
Nuclear localization signal 198..204 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 22/106 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.