DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Msx1

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_034965.2 Gene:Msx1 / 17701 MGIID:97168 Length:303 Species:Mus musculus


Alignment Length:68 Identity:33/68 - (48%)
Similarity:45/68 - (66%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMK 97
            |..|.|..:.:::.||.|::.||:.|||:|...:||:...|.|.|..|:|||.||||||||||.|
Mouse   162 PACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAK 226

  Fly    98 LKK 100
            .|:
Mouse   227 AKR 229

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 29/55 (53%)
Msx1NP_034965.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..112
PTZ00449 <99..>248 CDD:185628 33/68 (49%)