DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and ceh-10

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_498251.1 Gene:ceh-10 / 175811 WormBaseID:WBGene00000435 Length:344 Species:Caenorhabditis elegans


Alignment Length:214 Identity:54/214 - (25%)
Similarity:95/214 - (44%) Gaps:33/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTN 103
            |..|.:|.||.|:..|:.|||:.|..:.|.....|..::.:..|.|.::::||||||.|.:|:..
 Worm   132 SKRKKRRHRTIFTQYQIDELEKAFQDSHYPDIYAREVLAGKTELQEDRIQVWFQNRRAKWRKTEK 196

  Fly   104 ---------RKGAIGALTT-SIPLS---SQSSEDLQKDDQIVERLLRYANTNVETAP-LRQVDHG 154
                     ..|..||:.. |:||.   ::|:|...........||.....::|.|. |..|:..
 Worm   197 TWGKSTIMAEYGLYGAMVRHSLPLPETITKSAEAADPQQSAAPWLLGMHKKSMEAAAHLESVEKC 261

  Fly   155 VLEEGQ-----ITPPYQSYDYLHEFSPEPM--ALPQLPFNEFDANWASSWLGLEPTIPIAENVIE 212
            .:.:..     :|||.|. ...:|:.|..:  ...|.|.::       |.|..:.::.::.::.:
 Worm   262 DMSDSDDDDRPVTPPVQR-QVKNEYKPRIIEHVQQQAPQHQ-------SSLNFDTSLVVSSSLSQ 318

  Fly   213 HNTQDQPMIQNFCWDSNSS 231
            .:.||..||.|    :|:|
 Worm   319 LHFQDSQMIPN----NNAS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 19/52 (37%)
ceh-10NP_498251.1 Homeobox 139..192 CDD:278475 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I4098
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.