DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and DLX1

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_835221.2 Gene:DLX1 / 1745 HGNCID:2914 Length:255 Species:Homo sapiens


Alignment Length:96 Identity:40/96 - (41%)
Similarity:51/96 - (53%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQN 93
            ||..........:|.::.||.:|||||..|.|.|...:|||...|.|::..|.||:.||||||||
Human   114 VEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQN 178

  Fly    94 RRMKLKKSTNRKGAI---GALTTSIPLSSQS 121
            :|.|.||...:.||.   .||.....||:.|
Human   179 KRSKFKKLMKQGGAALEGSALANGRALSAGS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 28/55 (51%)
DLX1NP_835221.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..118 2/3 (67%)
Homeodomain 129..185 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..230 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.