DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and GSX2

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_573574.2 Gene:GSX2 / 170825 HGNCID:24959 Length:304 Species:Homo sapiens


Alignment Length:138 Identity:57/138 - (41%)
Similarity:74/138 - (53%) Gaps:14/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQ 78
            |:|:|...:.|:.:....|...     ...||.||||:|.||:||||||..|.||:|.|||||:.
Human   178 YNVADPRRFHCLTMGGSDASQV-----PNGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIAT 237

  Fly    79 RLALTERQVKIWFQNRRMKLK---KSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYAN 140
            .|.|:|:||||||||||:|.|   |.|.|....|.......:....|||   :|.:..   ..||
Human   238 YLNLSEKQVKIWFQNRRVKHKKEGKGTQRNSHAGCKCVGSQVHYARSED---EDSLSP---ASAN 296

  Fly   141 TNVETAPL 148
            .:.|.:||
Human   297 DDKEISPL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
GSX2NP_573574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151
Homeobox 206..258 CDD:306543 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..304 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155071
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.