DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxd3

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus


Alignment Length:234 Identity:78/234 - (33%)
Similarity:103/234 - (44%) Gaps:71/234 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGA 107
            |||.|||::|.||:|||:|||.|:||.|.||:|::..|.|||||:||||||||||.||....||.
Mouse   195 SKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGI 259

  Fly   108 IGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITP-PYQSYDYL 171
            :.:     | :.||.|                    .:.||......|...||:.| |..:||  
Mouse   260 LHS-----P-AGQSPE--------------------RSPPLGGAAGHVAYSGQLPPVPGLAYD-- 296

  Fly   172 HEFSPEPMA---------------------LPQ---LPFNEFD--------ANWASSWLGLEPTI 204
               :|.|.|                     |||   .|..||:        ..:||:.|...| :
Mouse   297 ---APSPPAFAKSQPNMYGLAAYTAPLSSCLPQQKRYPAPEFEPHPMASNGGGFASANLQGSP-V 357

  Fly   205 PIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDY 243
            .:..|.::........:.|....|:.||||      |||
Mouse   358 YVGGNFVDSMAPTSGPVFNLGHLSHPSSAS------VDY 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 37/55 (67%)
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 2/2 (100%)
Antp-type hexapeptide 161..166
Homeodomain 196..252 CDD:459649 37/55 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280 7/47 (15%)
DUF4074 370..431 CDD:463833 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.