Sequence 1: | NP_476794.1 | Gene: | zen2 / 40827 | FlyBaseID: | FBgn0004054 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034598.2 | Gene: | Hoxd3 / 15434 | MGIID: | 96207 | Length: | 433 | Species: | Mus musculus |
Alignment Length: | 234 | Identity: | 78/234 - (33%) |
---|---|---|---|
Similarity: | 103/234 - (44%) | Gaps: | 71/234 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGA 107
Fly 108 IGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITP-PYQSYDYL 171
Fly 172 HEFSPEPMA---------------------LPQ---LPFNEFD--------ANWASSWLGLEPTI 204
Fly 205 PIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDY 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
zen2 | NP_476794.1 | Homeobox | 46..99 | CDD:278475 | 35/52 (67%) |
Hoxd3 | NP_034598.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 44..198 | 2/2 (100%) | |
Antp-type hexapeptide | 161..166 | ||||
Homeobox | 199..251 | CDD:278475 | 35/51 (69%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 258..280 | 7/47 (15%) | |||
DUF4074 | 370..431 | CDD:290032 | 9/27 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 401..433 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
5 | 4.770 |