DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxd12

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_032300.2 Gene:Hoxd12 / 15432 MGIID:96204 Length:268 Species:Mus musculus


Alignment Length:67 Identity:30/67 - (44%)
Similarity:49/67 - (73%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKG 106
            ::::.|..::..|:.|||.||.:|:::.|.:|.|:|.||.|:::||||||||||||.|:...|:.
Mouse   199 RARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVQREQ 263

  Fly   107 AI 108
            |:
Mouse   264 AL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 27/55 (49%)
Hoxd12NP_032300.2 PHA03247 <37..123 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..124
Homeodomain 201..257 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.