DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxc4

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_038581.2 Gene:Hoxc4 / 15423 MGIID:96195 Length:264 Species:Mus musculus


Alignment Length:157 Identity:54/157 - (34%)
Similarity:73/157 - (46%) Gaps:45/157 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTE 84
            ::||.:: .:..:......:..:.||||||::..|::|||:|||.|:||.|.|||||:..|.|:|
Mouse   134 IVYPWMK-KIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSE 197

  Fly    85 RQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAP-- 147
            ||:||||||||||.||..                                  |..||.|.:||  
Mouse   198 RQIKIWFQNRRMKWKKDH----------------------------------RLPNTKVRSAPPA 228

  Fly   148 ------LRQVDHGVLEE--GQITPPYQ 166
                  |.....|..|:  ...|||.|
Mouse   229 GAAPSTLSAATPGTSEDHSQSATPPEQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
Hoxc4NP_038581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130
Antp-type hexapeptide 135..140 2/4 (50%)
Homeobox 159..213 CDD:365835 35/53 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 13/76 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.