DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxb3

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus


Alignment Length:170 Identity:58/170 - (34%)
Similarity:77/170 - (45%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNR 104
            |..|||:|||::|.||:|||:|||.|:||.|.||:|::..|.|:|||:||||||||||.||....
Mouse   188 SAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKA 252

  Fly   105 KGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQS-- 167
            ||...:.....|..| ..:.:|                 .||......|      .:||.|.|  
Mouse   253 KGLASSSGGPSPAGS-PPQPMQ-----------------STAGFMNALH------SMTPSYDSPS 293

  Fly   168 -----------YDYLHEFSP------EPMALPQLPFNEFD 190
                       |.....:.|      .|...|..|.:|::
Mouse   294 PPAFGKGHQNAYALPSNYQPPLKGCGAPQKYPPTPASEYE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/52 (65%)
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124
Antp-type hexapeptide 129..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 4/6 (67%)
Homeobox 195..248 CDD:365835 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 5/44 (11%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.