DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Gbx2

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_034392.1 Gene:Gbx2 / 14472 MGIID:95668 Length:348 Species:Mus musculus


Alignment Length:123 Identity:51/123 - (41%)
Similarity:69/123 - (56%) Gaps:21/123 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FAIQSENYFVDNYSVSDLMMYPCVELNVEAAP-------------TATTRSSEKSKRSRTAFSSL 53
            |:::|:   || ||..|.:  |....:.|..|             ..:|.|:.|::|.||||:|.
Mouse   199 FSLESD---VD-YSSDDNL--PGQTAHKEEDPGHALEETPQSGGAAGSTTSTGKNRRRRTAFTSE 257

  Fly    54 QLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLK--KSTNRKGAIG 109
            ||:|||:|||..|||:.|.|.:|:..|.|:|.||||||||||.|.|  |:.|.....|
Mouse   258 QLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 33/52 (63%)
Gbx2NP_034392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 14/57 (25%)
Homeobox 250..304 CDD:395001 33/53 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.