DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Antp

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_061506838.1 Gene:Antp / 1272720 VectorBaseID:AGAMI1_006863 Length:324 Species:Anopheles gambiae


Alignment Length:73 Identity:42/73 - (57%)
Similarity:51/73 - (69%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKST 102
            ||..:.||.|..::..|.:|||:|||.|:||.|.|||||:..|.|||||:||||||||||.||..
Mosquito   239 RSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN 303

  Fly   103 NRKGAIGA 110
            ..||..|:
Mosquito   304 KTKGEPGS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 35/55 (64%)
AntpXP_061506838.1 None

Return to query results.
Submit another query.