DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Barx2

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_038828.2 Gene:Barx2 / 12023 MGIID:109617 Length:283 Species:Mus musculus


Alignment Length:160 Identity:54/160 - (33%)
Similarity:77/160 - (48%) Gaps:9/160 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNR 94
            |:.....|...:|.:||||.|:.|||:.||::|...|||:...|::::|.|.||:.|||.|:|||
Mouse   124 ESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNR 188

  Fly    95 RMKLKKSTNRKGAIGALT--------TSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQV 151
            |||.||.. .||...|.|        .|||.|.:...:.:.:.|...:.|..::...|.....|.
Mouse   189 RMKWKKMV-LKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQELLESSERQEEPCDTQE 252

  Fly   152 DHGVLEEGQITPPYQSYDYLHEFSPEPMAL 181
            ....|...::..|......|.|.|.||..|
Mouse   253 PKACLVPLEVAEPIHQPQELSEASSEPPPL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 28/52 (54%)
Barx2NP_038828.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..141 4/16 (25%)
Homeobox 140..193 CDD:306543 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..283 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.