DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment zen2 and Vsx1

DIOPT Version :9

Sequence 1:	NP_476794.1	Gene:	zen2 / 40827	FlyBaseID:	FBgn0004054	Length:	252	Species:	Drosophila melanogaster
Sequence 2:	NP_473409.1	Gene:	Vsx1 / 114889	MGIID:	1890816	Length:	363	Species:	Mus musculus

Alignment Length:	98	Identity:	33/98 - (33%)
Similarity:	48/98 - (48%)	Gaps:	13/98 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNR-- 104
            |.:|.||.|::.||.|||:.|....|.....|..::.:..|.|.::::||||||.|.:|...|
Mouse   170 KKRRHRTVFTAHQLEELEKAFGEAHYPDVYAREMLAAKTELPEDRIQVWFQNRRAKWRKREKRWG 234

  Fly   105 -------KGAIGALTT-SIPLSS---QSSEDLQ 126
                   .|..||:.. .|||..   .|::.||
Mouse   235 GSSVMAEYGLYGAMVRHCIPLPDSVLNSADSLQ 267

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
zen2	NP_476794.1	Homeobox	46..99	CDD:278475	20/52 (38%)
Vsx1	NP_473409.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..25
		Octapeptide motif	31..38
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	42..66
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	122..166
		Nuclear localization signal. /evidence=ECO:0000255	168..173		1/2 (50%)
		Homeobox	174..227	CDD:278475	20/52 (38%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	300..363
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910