DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxa1

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_037207.2 Gene:Hoxa1 / 103690132 RGDID:11414885 Length:334 Species:Rattus norvegicus


Alignment Length:103 Identity:45/103 - (43%)
Similarity:61/103 - (59%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNVEAAPTATTRSSE-----KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQ 86
            :.|:..|..|.:..|     :....||.|::.||.|||:|||.||||.|.||:||:..|.|.|.|
  Rat   207 MKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQ 271

  Fly    87 VKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSED 124
            |||||||||||.|| ..::|.:.....:.|.|.:.:|:
  Rat   272 VKIWFQNRRMKQKK-REKEGLLPISPATPPGSDEKTEE 308

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 35/55 (64%)
Hoxa1NP_037207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..82
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 74..202
COG5576 175..>285 CDD:227863 39/77 (51%)