DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxa2

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_036713.2 Gene:Hoxa2 / 103690123 RGDID:2813 Length:372 Species:Rattus norvegicus


Alignment Length:253 Identity:74/253 - (29%)
Similarity:116/253 - (45%) Gaps:71/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKST----- 102
            |:|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:||||||||.|:.|     
  Rat   139 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKEN 203

  Fly   103 -NRKGAIGALTTSIPLSSQSSEDLQKDDQ---IVERLLRYANTNVE---------TAPLRQVDHG 154
             |.:|....|        :.|:.:::|::   :.|:.|..:...:|         ....:|..:|
  Rat   204 QNSEGKFKNL--------EDSDKVEEDEEEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNG 260

  Fly   155 VLEEGQITP--PYQSYDY--------------------------LHEFSPEPMALPQL-PFNEFD 190
            ...:.|..|  |..|.:.                          |:..|||.:.:|.| .||.|.
  Rat   261 HNGDSQTFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFNVFS 325

  Fly   191 ANWASSWL----GLEPTIPIAENVIEHNTQDQPM-IQNFCWDSNSSSASSSDILDVDY 243
            .:   |.|    .|.|::|        .:.|.|: |....:|..:.:.::.|:..::|
  Rat   326 TD---SCLQLSDALSPSLP--------GSLDSPVDISADSFDFFTDTLTTIDLQHLNY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
Hoxa2NP_036713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..96
Antp-type hexapeptide 96..101
Homeobox 143..196 CDD:395001 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.