DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxa4

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_077326.1 Gene:Hoxa4 / 100912525 RGDID:2814 Length:285 Species:Rattus norvegicus


Alignment Length:81 Identity:42/81 - (51%)
Similarity:59/81 - (72%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTE 84
            ::||.:: .:..:....:.:..:.||||||::..|::|||:|||.|:||.|.|||||:..|.|:|
  Rat   158 VVYPWMK-KIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSE 221

  Fly    85 RQVKIWFQNRRMKLKK 100
            |||||||||||||.||
  Rat   222 RQVKIWFQNRRMKWKK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
Hoxa4NP_077326.1 Homeobox 183..236 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.