DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and mnx1

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_002935225.2 Gene:mnx1 / 100496534 XenbaseID:XB-GENE-919890 Length:338 Species:Xenopus tropicalis


Alignment Length:130 Identity:49/130 - (37%)
Similarity:72/130 - (55%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IQSENYFVDNY---SVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLN 65
            |.:..:.:|.:   |.:.:|:....:.|.:    |.:....|.:|.||||:|.||:|||.:|.||
 Frog   139 ISAGTFQLDQWLRASTAGMMLPKMADFNSQ----AQSNLLGKCRRPRTAFTSQQLLELEHQFKLN 199

  Fly    66 KYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDDQ 130
            |||:|.:|.|::..|.|||.||||||||||||.|:|...|             .|:.:|.:|..:
 Frog   200 KYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAK-------------EQAVQDAEKQQR 251

  Fly   131  130
             Frog   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
mnx1XP_002935225.2 Homeobox 180..234 CDD:395001 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.