DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxa2

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_004915456.1 Gene:hoxa2 / 100038099 XenbaseID:XB-GENE-488087 Length:373 Species:Xenopus tropicalis


Alignment Length:244 Identity:79/244 - (32%)
Similarity:108/244 - (44%) Gaps:66/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AAPTATT------------RSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALT 83
            |||..|.            .||..|:|.|||:::.||:|||:|||.||||.|.||:||:..|.||
 Frog   116 AAPATTACLSHKEIIEIQDNSSGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLT 180

  Fly    84 ERQVKIWFQNRRMKLKKST------NRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTN 142
            |||||:||||||||.|:.|      |..|....|           :|.:|.::..|:.|      
 Frog   181 ERQVKVWFQNRRMKHKRQTQCKENQNGDGKFKHL-----------DDSEKGEEEKEKSL------ 228

  Fly   143 VETAPLRQVDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIPI- 206
            .|.| |..|...:||.       .||.:      :..||.|...:......:.|:    |..|: 
 Frog   229 FEQA-LNSVSGALLER-------DSYSF------QQNALAQQQSHNSHNGDSQSF----PVSPLS 275

  Fly   207 -AENVIEHNTQDQPMIQNFCWDS---------NSSSASSSDILDVDYDF 245
             :|..:.|..|..|..|| |..:         |:.|..:.|:..:. ||
 Frog   276 NSEKNLRHFQQQSPTAQN-CLSTIAQDCAAGLNNDSPEALDVASLT-DF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
hoxa2XP_004915456.1 Homeobox 144..197 CDD:365835 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.