DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxd3

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_002935734.1 Gene:hoxd3 / 100038058 XenbaseID:XB-GENE-478462 Length:415 Species:Xenopus tropicalis


Alignment Length:229 Identity:77/229 - (33%)
Similarity:105/229 - (45%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNR 94
            |.:||..:     |||.|||::|.||:|||:|||.|:||.|.||:|::..|.|||||:|||||||
 Frog   172 EKSPTGPS-----SKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNR 231

  Fly    95 RMKLKKSTNRKGAIGALTTSIP-----LSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHG 154
            |||.||....||.:.:.....|     ||..:..........|..|...|.:....|..:|..:|
 Frog   232 RMKYKKDQKAKGIMHSPAGQSPDRSPTLSGSNHVGYSSQLPTVNSLSYDAPSPTSFAKSQQNMYG 296

  Fly   155 VLEEGQITPPYQSYDYLHEFSPEPMALPQ---LPFNEFD-------ANWASSWLGLEPTIPIAEN 209
            :   ...|.|..|            .|||   .|..|::       :.:|:..|...| :.:..|
 Frog   297 L---AAYTAPLSS------------CLPQQKRYPGAEYEHHTMQGNSGFANPNLQGSP-VYVGGN 345

  Fly   210 VIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDY 243
            .::......||. |....|:.||||      |||
 Frog   346 FVDSMPASGPMF-NVGHLSHPSSAS------VDY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
hoxd3XP_002935734.1 Homeobox 184..237 CDD:365835 35/52 (67%)
DUF4074 352..413 CDD:372548 11/28 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.