DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and YHP1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:56/248 - (22%)
Similarity:97/248 - (39%) Gaps:75/248 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 KEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAA 233
            ||||.|.....::.:........:....|.||.|...::.:|..|:..|.......:.:|||::.
Yeast   144 KEKKRSFAFITHSQETFPKKEPKIDNARLARRKRRRTSSYELGILQTAFDECPTPNKAKRIELSE 208

  Fly   234 SLDLTERQVKVWFQNRRM---KHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKKSCQGCELPSD 295
            ..:::|:.|::||||:|.   |||                         ||.             
Yeast   209 QCNMSEKSVQIWFQNKRQAAKKHK-------------------------NSG------------- 235

  Fly   296 DIPDSTSNSRGHNNNTPSATNNNPSAGNLTPNSSLETGISSNLMGSTTVSASNVISAD---SSVA 357
                :||:.:.|:|::.|..:.:.:|..:|               ||..|....|:|:   :|.|
Yeast   236 ----NTSHCKVHSNDSMSMISYSDAALEIT---------------STPTSTKEAITAELLKTSPA 281

  Fly   358 SSVSLDED--IEESSP---IKVKKKDDGQVIKKEAVSTSSKA----SPFGYEN 401
            ::.|:.||  |....|   :|..:|   .|:.|..:|.:..:    ||.|.||
Yeast   282 NTSSIFEDHHITPCKPGGQLKFHRK---SVLVKRTLSNTGHSEIIKSPKGKEN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 25/107 (23%)
Homeobox 202..254 CDD:278475 15/54 (28%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 39/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.