DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and gsx1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:315 Identity:89/315 - (28%)
Similarity:117/315 - (37%) Gaps:140/315 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QIKSESPLNPLQVQTGQT--SLPVGGCGG--AGVVGGVGGVGVSVGQPGIGQQGVPPVPSVLMVN 76
            :::|..||.|..|.....  .||.|.|..  :|::                              
 Frog    19 KVESSPPLFPYAVHPTHPLHGLPAGSCHSRKSGLL------------------------------ 53

  Fly    77 KMTPNCDKRSADTAYWMTASEGGFINSQPSMAEFLNHLSPESPKI----------GT---PVGSG 128
            .:.|.|          :|||                ||.|..|.|          ||   |.|.|
 Frog    54 CVCPMC----------VTAS----------------HLHPPPPGIPLLKASFSSFGTQYCPAGLG 92

  Fly   129 AIGGVGVNVNVNVGVGV---GYPVGVVPQTPD-------GMDSVPEYPWMKEKKTSRKSSNNNNQ 183
            ........:||:.|..:   .||:      ||       .:||.|          |:.||:    
 Frog    93 RQHSASTGINVSHGPALYQAAYPL------PDPRQFHCISVDSSP----------SQLSSS---- 137

  Fly   184 GDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQN 248
                           :|:|||:|:|||||||:||..|.||.|.||||||..|:|:|:|||:||||
 Frog   138 ---------------KRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQN 187

  Fly   249 RRMKHKRQTLSKT--------------------DDED--NKDSLKGDDDQSDSNS 281
            ||:|||::..|.|                    ||||  ...|..|.||:..|.|
 Frog   188 RRVKHKKEGKSSTHRASPHGCKCSSLSSKCLEEDDEDLAMSPSSSGKDDRDLSPS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 50/127 (39%)
Homeobox 202..254 CDD:278475 36/51 (71%)
gsx1NP_001039254.1 homeobox 137..196 39/77 (51%)
Homeobox 141..194 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.