DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxa6

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:266 Identity:83/266 - (31%)
Similarity:109/266 - (40%) Gaps:82/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LNPLQVQTGQTSLPVGGCGGAGVVGGVGGVGVSVGQPGIGQQGVPPVPSVLMVNKMT----PNCD 83
            |.|.....|.:|||                ..:...|...||.    .|||..|:.:    .:|.
  Rat    35 LRPFPASYGASSLP----------------DKTYTSPCFYQQS----NSVLACNRASYEYGASCF 79

  Fly    84 KRSADTAYWMTASEGGFINS-QPSMAEFLNHLSPE---SPKIGTPVGSGAIGGVGVNVNVNVGVG 144
            ....|.:   .||..|  || |....::| |.|||   .|      .|.::.|..::        
  Rat    80 YSDKDLS---GASPSG--NSKQRGPGDYL-HFSPEQQYKP------DSSSVQGKALH-------- 124

  Fly   145 VGYPVGVVPQTPDGMD---SVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYT 206
                       .:|.|   :.|.|||| ::..|...:...:.|              ||.|..||
  Rat   125 -----------EEGTDRKYTSPVYPWM-QRMNSCAGAVYGSHG--------------RRGRQTYT 163

  Fly   207 NTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLK 271
            ..|.||||||||||:||.|.||||||.:|.|||||:|:||||||||.|     |.:...|.....
  Rat   164 RYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWK-----KENKLINSTQAS 223

  Fly   272 GDDDQS 277
            |:|.::
  Rat   224 GEDSEA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 47/105 (45%)
Homeobox 202..254 CDD:278475 38/51 (75%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 39/57 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.