DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Mnx1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001258203.1 Gene:Mnx1 / 682076 RGDID:1588091 Length:403 Species:Rattus norvegicus


Alignment Length:367 Identity:99/367 - (26%)
Similarity:136/367 - (37%) Gaps:96/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSLDTTSMGTQIKSESPLNPLQVQTGQTSLPVGGCGGAGVVGGVGGVGVSVGQPGIGQQGVPPVP 70
            ||..|.:.|.::::|||..|..:......||..|..||      ||.|.:.|.||.......|  
  Rat    63 SSEATAAPGDRLRAESPSPPRLLTAHCALLPKPGFLGA------GGGGGAAGGPGTPHHHAHP-- 119

  Fly    71 SVLMVNKMTPNCDKRSADTAYWMTASEGGF-INSQPSMAEFLNHLSPESPKIGTPVGS-GAIGGV 133
                        ...:|..|....|:.||. :...|..|:....|..::...|.||.| .|....
  Rat   120 ------------GAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPVYSYSAAAAA 172

  Fly   134 GVNVNVNVGVGVGYP--VGVVPQTPD-----GMDSVPEYPWMKEKKTSR---KSSNNNNQGDNSI 188
            ......:..:...||  .|..|..|.     |..:.....|::......   |..:.::|..:::
  Rat   173 AALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLRASTAGMILPKMPDFSSQAQSNL 237

  Fly   189 TEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKH 253
            .      |..||.|||:|:.||||||.:|..||||.||:|.|:|.||.|||.|||:||||||||.
  Rat   238 L------GKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKW 296

  Fly   254 KRQ-------------------------TLSKTDDE-----------------DNKDSLKGDDDQ 276
            ||.                         |..||::|                 |.:|| ..|:|:
  Rat   297 KRSKKAKEQAAQEAEKQKGSGGGAGKGGTEEKTEEELLGPPVSGDKASGRRLRDLRDS-DPDEDE 360

  Fly   277 SDSNSN-----------SKKSCQGCELPSDDIPDSTSNSRGH 307
            .|...:           :...|..    .||.|.......||
  Rat   361 DDEEDHFPYSNGVGAHAASSDCSS----EDDSPPPRPGGPGH 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 50/150 (33%)
Homeobox 202..254 CDD:278475 36/51 (71%)
Mnx1NP_001258203.1 Homeobox 244..297 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.