DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxc13a

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_571618.1 Gene:hoxc13a / 58059 ZFINID:ZDB-GENE-000822-4 Length:306 Species:Danio rerio


Alignment Length:106 Identity:36/106 - (33%)
Similarity:62/106 - (58%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 WMKEKKTSRKSSNNNNQGDNSITEFVP--------ENGLPRRLRTAYTNTQLLELEKEFHFNKYL 223
            |..:...|::.:.:::...:...:.||        ..|  |:.|..||..||.|||||:..:|::
Zfish   199 WDGQVYCSKEQTQSSHLWKSPFPDVVPLQPEVSSYRRG--RKKRVPYTKIQLKELEKEYAASKFI 261

  Fly   224 CRPRRIEIAASLDLTERQVKVWFQNRRMKHKR-QTLSKTDD 263
            .:.:|..|:|:.:|:||||.:||||||:|.|: .:.|||::
Zfish   262 TKDKRRRISATTNLSERQVTIWFQNRRVKEKKFVSKSKTNN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 27/55 (49%)
hoxc13aNP_571618.1 HoxA13_N 34..144 CDD:463521
Homeodomain 237..293 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.