DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxc1a

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a / 58046 ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio


Alignment Length:249 Identity:76/249 - (30%)
Similarity:103/249 - (41%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PGIGQQGVPPVPSVLMVNK-----MTPNCDKRSADTAYWMTASEG----GFINSQPSMAEF---- 110
            ||......||.|.    |:     :.||   |....::.....:|    ||..|..:...|    
Zfish    71 PGRANSTRPPFPQ----NQDFYRPVHPN---RPQVPSFQSCREQGLSRKGFSPSSDTFRTFSSAH 128

  Fly   111 -----LNHLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSVPEYPWMKE 170
                 :|:...|......||...|:      .:.|.|.|.   :..:.:|   :.|...:.||:.
Zfish   129 CELGPVNNTQTEVRTYDGPVRHSAV------EDDNTGHGA---LNTLNET---LHSGKTFEWMRV 181

  Fly   171 KKTSRKSSN-----------NNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLC 224
            ::...:::.           ..|.|.:| .|.....|    .||.:|..||.||||||||||||.
Zfish   182 RRNQSRAAKIQLGKCSDRELKTNHGRDS-DEDTSSGG----SRTNFTTKQLTELEKEFHFNKYLT 241

  Fly   225 RPRRIEIAASLDLTERQVKVWFQNRRMKHKRQ---------TLSKTDDEDNKDS 269
            |.||||||..|.|:|.|||:||||||||.|:.         .|....|||:|.|
Zfish   242 RARRIEIANPLQLSETQVKIWFQNRRMKQKKMLREGLAQGLMLISGCDEDSKKS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 51/122 (42%)
Homeobox 202..254 CDD:278475 38/51 (75%)
hoxc1aNP_571606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224 7/30 (23%)
Homeobox 218..271 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.