DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxb7a

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001108563.1 Gene:hoxb7a / 58044 ZFINID:ZDB-GENE-000329-2 Length:227 Species:Danio rerio


Alignment Length:213 Identity:68/213 - (31%)
Similarity:101/213 - (47%) Gaps:37/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 NCDKRSADTAYWMTASEGGFINSQ-----PSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVN 140
            :|..:.|  :.:.:||.|..::|.     |||  :.|..|..|...|....:..:|.|.:|::  
Zfish    35 SCSSQRA--SGYGSASTGAPVSSSSSVSLPSM--YTNGTSLSSHTQGMYPTAYELGAVSLNMH-- 93

  Fly   141 VGVGVGYPVGVVPQTPDGMDSVPEYPWM---------KEKKTSRKSSNNNNQGDNSITEFVPENG 196
                            ..:...|..|.:         ...|..::..:.||:.:..|..::...|
Zfish    94 ----------------SSLFDHPNLPMVSAGDLCKAQSSGKEEQRGYHQNNENNLRIYPWMRSTG 142

  Fly   197 LPR-RLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSK 260
            ..| |.|..|:..|.||||||||||:||.|.||||||.:|.|||||:|:||||||||.|::..|.
Zfish   143 ADRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKST 207

  Fly   261 TDDEDNKDSLKGDDDQSD 278
            .......|.:.||:::.|
Zfish   208 DRCSPAADQIGGDEEEED 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 48/115 (42%)
Homeobox 202..254 CDD:278475 37/51 (73%)
hoxb7aNP_001108563.1 Antp-type hexapeptide 134..139 1/4 (25%)
Homeobox 149..201 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..227 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.