DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and NKX3-2

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001180.1 Gene:NKX3-2 / 579 HGNCID:951 Length:333 Species:Homo sapiens


Alignment Length:221 Identity:63/221 - (28%)
Similarity:93/221 - (42%) Gaps:65/221 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GCGGAGVVGGVGGVGVSVGQPGIGQQGVPPVPSVLMVNKMTPNCDKRSADTAYWMTASEGGFINS 103
            |..|||:.||    .:|:||         ||..:.....:......||...   |:||..|  :.
Human   112 GASGAGLAGG----SLSLGQ---------PVCELAASKDLEEEAAGRSDSE---MSASVSG--DR 158

  Fly   104 QPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSVPEYPWM 168
            .|...:  :.:.|....: :.:.|||.||.|..           |.||..:     :..|..|  
Human   159 SPRTED--DGVGPRGAHV-SALCSGAGGGGGSG-----------PAGVAEE-----EEEPAAP-- 202

  Fly   169 KEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAA 233
            |.:|                          :|.|.|:::.|:.|||:.|:..:||..|.|.::||
Human   203 KPRK--------------------------KRSRAAFSHAQVFELERRFNHQRYLSGPERADLAA 241

  Fly   234 SLDLTERQVKVWFQNRRMKHKRQTLS 259
            ||.|||.|||:||||||.|.||:.::
Human   242 SLKLTETQVKIWFQNRRYKTKRRQMA 267

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 29/55 (53%)