DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxa1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001008017.1 Gene:hoxa1 / 493379 XenbaseID:XB-GENE-480737 Length:323 Species:Xenopus tropicalis


Alignment Length:148 Identity:59/148 - (39%)
Similarity:73/148 - (49%) Gaps:26/148 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 YPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRI 229
            :.|||.|:...|:......|      |.   |.|...||.:|..||.||||||||||||.|.||:
 Frog   193 FDWMKVKRNPPKTGKAGEYG------FA---GQPNTARTNFTTKQLTELEKEFHFNKYLTRARRV 248

  Fly   230 EIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSL--------KGDDDQSDSNSNSKKS 286
            ||||:|.|.|.|||:||||||||.|::         .|:.|        .|.|::|:..|....|
 Frog   249 EIAAALQLNETQVKIWFQNRRMKQKKR---------EKEGLLPISPSASTGSDEKSEELSEKSNS 304

  Fly   287 CQGCELPSDDIPDSTSNS 304
            ......|:....|..|.|
 Frog   305 SPCAPSPASSTSDHLSTS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 50/113 (44%)
Homeobox 202..254 CDD:278475 38/51 (75%)
hoxa1NP_001008017.1 Homeobox 221..274 CDD:365835 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.